PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008245332.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 425aa    MW: 47786.9 Da    PI: 4.7333
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008245332.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM122.63.4e-38461672128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     ppG rF Ptdeel+v+yL++++ +++      i ++diy++ P +L + ++  e+  ++f+++r++ky++gkr++r+++ gyWkatgkd+++++ 
  XP_008245332.1  46 PPGWRFCPTDEELIVFYLRNRTWNNS-----RIIHLDIYDFTPMQLAEYFEIpEDPVMFFYTTRKRKYKNGKRPSRTANIGYWKATGKDTRITE- 134
                     9*******************998887.....35689**********976666345588***********************************9. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +  vg+kk+Lvfy g++++g+ktdW+mhey+l
  XP_008245332.1 135 IDGSVGVKKSLVFYLGQQKEGKKTDWIMHEYTL 167
                     6778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-4333182IPR003441NAC domain
PROSITE profilePS5100540.0545183IPR003441NAC domain
PfamPF023658.8E-2246167IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MASTSDPAAN KGKAPALYGD DDDDRHRDMV TKMMMMREER VSMGIPPGWR FCPTDEELIV  60
FYLRNRTWNN SRIIHLDIYD FTPMQLAEYF EIPEDPVMFF YTTRKRKYKN GKRPSRTANI  120
GYWKATGKDT RITEIDGSVG VKKSLVFYLG QQKEGKKTDW IMHEYTLQKE EFEACVLCKV  180
YETSRGRNSR QNTRNEANTV SNDDGEQGTN PSTTRSQAEE DQALRFLPLP PPPRNIYCGS  240
SSSSSSSNLA GQYDVHMTNH SDHALNNVSF PQCTWASNGL GAHPEVTTLA PMAHAQLENS  300
IPLLHSMNIY DQDGYLLNEN IEYYQSTAPY GFGAQSLPIY NNVSQPNNSG YGMAPTDTTE  360
EEEELYLLHE PLPDFSFQID DNAECVPFGM PVESAKPLNS VTPTDPVTQS TNPGGNSTTT  420
PMDGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-314318215164NO APICAL MERISTEM PROTEIN
1ut4_B8e-314318215164NO APICAL MERISTEM PROTEIN
1ut7_A8e-314318215164NO APICAL MERISTEM PROTEIN
1ut7_B8e-314318215164NO APICAL MERISTEM PROTEIN
4dul_A8e-314318215164NAC domain-containing protein 19
4dul_B8e-314318215164NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008245332.10.0PREDICTED: NAC domain-containing protein 55-like
TrEMBLM5VS951e-154M5VS95_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2051144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-39NAC-like, activated by AP3/PI